PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10019409m
Common NameCARUB_v10019409mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 244aa    MW: 28712.9 Da    PI: 6.0749
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10019409mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.2e-171158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W +eEde+lv+ v++lG ++W++ a   g++R++k+c++rw +yl
  Carubv10019409m 11 RGPWLEEEDERLVKFVTLLGERRWDSLAIVSGLKRSGKSCRLRWMNYL 58
                     89********************************************97 PP

2Myb_DNA-binding50.54.9e-1665108247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g++++eE  +++++++++G++ W++Iar+++ gRt++++k++w+++
  Carubv10019409m  65 GPMSQEEVRIILQLHALWGNK-WSKIARRLP-GRTDNEIKNYWRTH 108
                      799******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.752658IPR017930Myb domain
SuperFamilySSF466896.53E-279105IPR009057Homeodomain-like
SMARTSM007177.2E-131060IPR001005SANT/Myb domain
PfamPF002494.1E-141158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-191265IPR009057Homeodomain-like
CDDcd001673.96E-81358No hitNo description
PROSITE profilePS5129426.72859113IPR017930Myb domain
SMARTSM007173.6E-1663111IPR001005SANT/Myb domain
PfamPF002491.7E-1465108IPR001005SANT/Myb domain
CDDcd001672.98E-1066109No hitNo description
Gene3DG3DSA:1.10.10.606.8E-2466112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MECKKGETLR RGPWLEEEDE RLVKFVTLLG ERRWDSLAIV SGLKRSGKSC RLRWMNYLNP  60
NLKHGPMSQE EVRIILQLHA LWGNKWSKIA RRLPGRTDNE IKNYWRTHFR KKEEAQNYDK  120
ITDWRGNIGE DLLHKYNETE ITRTRMTSQE HGFDETVKEC NQRSMESGQE TNGSIFERES  180
FGIMNSPYEN RISDWISEIS TDQSEANVSE GNSSSTSEKN INIASWWFQE TRDFEEFSCS  240
LWS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2791122104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1172561e-165AK117256.1 Arabidopsis thaliana At3g53200 mRNA for putative transcription factor (MYB27), complete cds, clone: RAFL16-81-D10.
GenBankAY5195991e-165AY519599.1 Arabidopsis thaliana MYB transcription factor (At3g53200) mRNA, complete cds.
GenBankBT0052571e-165BT005257.1 Arabidopsis thaliana At3g53200 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293114.11e-180hypothetical protein CARUB_v10019409mg
TrEMBLR0FT621e-180R0FT62_9BRAS; Uncharacterized protein
STRINGAT3G53200.11e-141(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113972533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.11e-144myb domain protein 27